Coach-Poppy-by-Coach-For-Women

Coach Poppy by Coach For Women

$56.99 USD

Coach Poppy by Coach For Women is a delightful and exuberant fragrance to captures the youthful spirit and vibrant energy of the modern woman. This perfume exudes a playful and feminine...

Size: Eau De Parfum Spray 3.4 ozSize Guide

Eau De Parfum Spray 3.4 oz

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Coach
SKU: 500108
Availability: In Stock Pre order Out of stock
Categories: Sale Women Perfumes
sold in last hours
Order in the next [totalHours] hours %M minutes to get it between and
Product Description

Coach Poppy by Coach For Women is a delightful and exuberant fragrance to captures the youthful spirit and vibrant energy of the modern woman. This perfume exudes a playful and feminine charm, perfect for any occasion. Coach Poppy is a must-have addition to any fragrance collection housed in a stylish and elegant bottle adorned with a playful poppy motif.

Band Detail:

Coach is a renowned American luxury fashion brand established in 1941. It is known for its exceptional craftsmanship and innovative design. Coach has become synonymous with effortless New York style and sophisticated elegance. Coach continues to set the standard for modern luxury, offering a wide range of high-end fragrances that appeal to a global audience.

Uses:

It is perfect to wear at daily adventures, date nights, and parties. 

Fragrance Family: Fruity
Top Notes: fresh cucumber, juicy mandarin, and freesia
Heart Notes: jasmine, pink water lily, Southern gardenia, red candied rose petals
Base Notes:  creamy vanilla, whipped marshmallow, musk, sandalwood
Gender: Women
Ingredients: Water, Alcohol Denatured, Limonene, Linalool.
Brand Details

Coach is a renowned American luxury fashion brand established in 1941. It is known for its exceptional craftsmanship and innovative design. Coach has become synonymous with effortless New York style and sophisticated elegance. Coach continues to set the standard for modern luxury, offering a wide range of high-end fragrances that appeal to a global audience.