Coach-Poppy-by-Coach-For-Women-Eau-De-Parfum-Spray-1-oz
Coach-Poppy-by-Coach-For-Women-Eau-De-Parfum-Spray-3.4-oz

Coach Poppy by Coach For Women

$94.99 USD $65.99 USD SAVE 31%

Size: Eau De Parfum Spray 1 ozSize Guide (Oz to Ml)

Eau De Parfum Spray 1 oz
Eau De Parfum Spray 3.4 oz

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Coach
SKU: 501859
Barcode: 3386460095518
Availability: In Stock Pre order Out of stock
Add More to Cart, Save Upto 06% — Limited Time Offer
Product Description

Coach Poppy by Coach For Women is a delightful and exuberant fragrance to captures the youthful spirit and vibrant energy of the modern woman. This perfume exudes a playful and feminine charm, perfect for any occasion. Coach Poppy is a must-have addition to any fragrance collection housed in a stylish and elegant bottle adorned with a playful poppy motif.

Band Detail:

Coach is a renowned American luxury fashion brand established in 1941. It is known for its exceptional craftsmanship and innovative design. Coach has become synonymous with effortless New York style and sophisticated elegance. Coach continues to set the standard for modern luxury, offering a wide range of high-end fragrances that appeal to a global audience.

Uses:

It is perfect to wear at daily adventures, date nights, and parties. 

Fragrance Family: Fruity
Top Notes: fresh cucumber, juicy mandarin, and freesia
Heart Notes: jasmine, pink water lily, Southern gardenia, red candied rose petals
Base Notes:  creamy vanilla, whipped marshmallow, musk, sandalwood
Gender: Women
Ingredients: Water, Alcohol Denatured, Limonene, Linalool.
Authenticity & Security

Authentic & Original Fragrances

At The Perfume Shop , we offer authentic fragrances. Every perfume, cologne, and beauty product listed on our website is sourced through established distributors and reputable wholesale partners. We focus on accurate product details, clear images, and barcodes/packaging information (where available), so you can shop with confidence.

Secure Shopping & Privacy

Your privacy and security are a top priority at The Perfume Shop USA. Our website uses SSL (Secure Socket Layer) encryption to protect your personal information such as your name, address, and payment details during checkout. This helps keep your data private and protected while you shop.

Shipping & Returns

1. Shipping & Return Questions

What is your shipping rates & policy?
Standard Shipping (USA)
  • Free for orders over $ 59.99, otherwise shipping is $ 5.99.
  • Orders to PO Box, HI, PR, AK, APO, FPO are shipped via USPS.
  • Ships via UPS, FedEx, or Postal Service.
  • Arrives in 3 - 5 business days.
  • Applicable sales tax is calculated at checkout based on your shipping address.

See Our Shipping Policy

2. Returns and Exchanges

Returns Policy

Easy returns within 30 days. If you would like to return a product from your order simply send the unopened product back to the address below in its original sealed packaging. You can expect a refund within one billing cycle of our receiving your returned product. If shipping was free for your order it will be deducted from the credit we apply to your credit card. Please note, we do not accept returns for cosmetics and skincare items due to health reasons, please make your selections carefully. Shipping cost is non-refundable for undelivered, unclaimed, returned and refused packages, unless we made an error.

Please contact with our support team for return queries. See Return Policy

Reviews

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Buy More Save More Discount Offer - The Perfume Shop