Shalimar by Guerlain For Women - Body Lotion 6.7 oz

Shalimar by Guerlain-Body Lotion 6.7 oz

$90.99 USD $80.99 USD SAVE 11%

Size: Body Lotion 6.7 ozSize Guide (Oz to Ml)

Body Lotion 6.7 oz

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Guerlain
SKU: 401499
Barcode: 3346470642027
Availability: In Stock Pre order Out of stock
Add More to Cart, Save Upto 06% — Limited Time Offer
Product Description

Shalimar by Guerlain Body Lotion is a rich, velvety lotion that leaves your skin feeling silky soft, and beautifully scented. This body lotion hydrates and nourishes the skin while enveloping you in a sensuous, oriental aroma. Perfect for daily use, the lotion absorbs quickly, leaving no greasy residue.

Brand Detail:

Guerlain is a prestigious French perfume house known for its pioneering creations in the world of fragrance. It was founded in 1828. Guerlain's craftsmanship and attention to detail have made it a symbol of luxury and refinement. Guerlain continues to enchant the world with scents that evoke emotion and elegance.

Use:

Shalimar by Guerlain Body Lotion is ideal for layering with the Shalimar Eau de Parfum to enhance the fragrance and extend its longevity throughout the day. 

Fragrance Family: Amber, spicy
Top Notes: Bergamot, Citrus, and Lemon
Heart Notes: Jasmine, Rose, and Iris
Base Notes:  Vanilla, Opoponax, and Tonka Bean
Gender: Women
Authenticity & Security

Authentic & Original Fragrances

At The Perfume Shop , we offer authentic fragrances. Every perfume, cologne, and beauty product listed on our website is sourced through established distributors and reputable wholesale partners. We focus on accurate product details, clear images, and barcodes/packaging information (where available), so you can shop with confidence.

Secure Shopping & Privacy

Your privacy and security are a top priority at The Perfume Shop USA. Our website uses SSL (Secure Socket Layer) encryption to protect your personal information such as your name, address, and payment details during checkout. This helps keep your data private and protected while you shop.

Shipping & Returns

1. Shipping & Return Questions

What is your shipping rates & policy?
Standard Shipping (USA)
  • Free for orders over $ 59.99, otherwise shipping is $ 5.99.
  • Orders to PO Box, HI, PR, AK, APO, FPO are shipped via USPS.
  • Ships via UPS, FedEx, or Postal Service.
  • Arrives in 3 - 5 business days.
  • Applicable sales tax is calculated at checkout based on your shipping address.

See Our Shipping Policy

2. Returns and Exchanges

Returns Policy

Easy returns within 30 days. If you would like to return a product from your order simply send the unopened product back to the address below in its original sealed packaging. You can expect a refund within one billing cycle of our receiving your returned product. If shipping was free for your order it will be deducted from the credit we apply to your credit card. Please note, we do not accept returns for cosmetics and skincare items due to health reasons, please make your selections carefully. Shipping cost is non-refundable for undelivered, unclaimed, returned and refused packages, unless we made an error.

Please contact with our support team for return queries. See Return Policy

Reviews

Customer Reviews

Based on 1 review
100%
(1)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
H
Haven
Effective lotion

I have been wearing Shalimar body lotion for over 50 years.The warm vanilla overotnes suit me expertly.

Buy More Save More Discount Offer - The Perfume Shop