Shalimar by Guerlain-Body Lotion 6.7 oz

$72.99 USD $63.99 USD SAVE 12%

Shalimar by Guerlain Body Lotion is a rich, velvety lotion that leaves your skin feeling silky soft, and beautifully scented. This body lotion hydrates and nourishes the skin while enveloping you...

Size: Body Lotion 6.7 ozSize Guide

Body Lotion 6.7 oz

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Guerlain
SKU: 401499
Availability: In Stock Pre order Out of stock
sold in last hours
Order in the next [totalHours] hours %M minutes to get it between and
Product Description

Shalimar by Guerlain Body Lotion is a rich, velvety lotion that leaves your skin feeling silky soft, and beautifully scented. This body lotion hydrates and nourishes the skin while enveloping you in a sensuous, oriental aroma. Perfect for daily use, the lotion absorbs quickly, leaving no greasy residue.

Brand Detail:

Guerlain is a prestigious French perfume house known for its pioneering creations in the world of fragrance. It was founded in 1828. Guerlain's craftsmanship and attention to detail have made it a symbol of luxury and refinement. Guerlain continues to enchant the world with scents that evoke emotion and elegance.

Use:

Shalimar by Guerlain Body Lotion is ideal for layering with the Shalimar Eau de Parfum to enhance the fragrance and extend its longevity throughout the day. 

Fragrance Family: Amber, spicy
Top Notes: Bergamot, Citrus, and Lemon
Heart Notes: Jasmine, Rose, and Iris
Base Notes:  Vanilla, Opoponax, and Tonka Bean
Gender: Women
Brand Details

Guerlain is a prestigious French perfume house known for its pioneering creations in the world of fragrance. It was founded in 1828. Guerlain's craftsmanship and attention to detail have made it a symbol of luxury and refinement. Guerlain continues to enchant the world with scents that evoke emotion and elegance.

Reviews

Customer Reviews

Based on 1 review
100%
(1)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
H
Haven
Effective lotion

I have been wearing Shalimar body lotion for over 50 years.The warm vanilla overotnes suit me expertly.