Pierre Cardin by Pierre Cardin For Men - Cologne/Eau De Toilette Spray 2.8 oz
Pierre Cardin by Pierre Cardin For Men - Body Spray 6 oz
Pierre Cardin by Pierre Cardin For Men - Cologne / Eau De Toilette Spray 8 oz

Pierre Cardin by Pierre Cardin For Men

$39.99 USD $26.99 USD SAVE 33%

Size: Cologne/Eau De Toilette Spray 2.8 ozSize Guide (Oz to Ml)

Cologne/Eau De Toilette Spray 2.8 oz
Body Spray 6 oz
Cologne / Eau De Toilette Spray 8 oz

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
SKU: 400620
Barcode: 603531175065
Availability: In Stock Pre order Out of stock
Add More to Cart, Save Upto 6% — Limited Time Offer
Product Description

About Pierre Cardin Perfume For Men

Launched in 1998, Pierre Cardin is a cologne from Pierre Cardin, created by perfumer Alberto Morillas, that leans amber-woody with benzoin and vanilla facets.

It comes in a angular bottle designed by Serge Mansau featuring the π motif; wears well for office hours, casual days and evening plans; balancing a fresh opening with a refined fragrance dry‑down; making this cologne a practical choice for shoppers who want an everyday scent without heaviness.

Pierre Cardin Fragrance Profile & Notes

  • Top Notes: Lemon, Bergamot, Orange, Lavender, Basil
  • Heart Notes: Carnation, Geranium, Leather, Sandalwood, Patchouli, Orris
  • Base Notes: Vanilla, Moss, Tonka Bean, Leather, Benzoin, Amber

The opening brings bright citrus, aromatic herbs and spice that flows into a balanced heart for a clean, modern character. It dries down to amber warmth, earthy mossy trail, vanillic sweetness, subtle leather, making this fragrance easy to wear daily and versatile across seasons.

Performance & Longevity of Pierre Cardin Perfume

On normal skin, the Eau de Toilette (EDT) concentration usually gives around 6–8 hours. Projection starts noticeable for the first 90 minutes and then settles to a personal scent bubble. If an Eau de Parfum (EDP) exists for this line, expect denser mid‑notes and an extra 1–2 hours of wear.

Season & setting: the fresh opening works during spring and summer days; the woody or amber base is well suited to autumn evenings. It handles casual plans, office use, and dinner plans with equal ease. Spraying once on a scarf or jacket can extend the trail without overdoing it.

Application tips: spray 3–4 times from 10–15 cm. Focus on pulse points (sides of neck, upper chest). For longer wear, lightly mist clothing from a distance; avoid delicate fabrics. If you have dry skin, urize first to help the scent last longer.

Care: store the bottle away from heat and direct sun. Proper storage preserves the color and the brightness of the top notes so the fragrance stays true from first to last spray.

Usage & pairing: pairs well with simple grooming products (unscented deodorant, mild aftershave balm) so the composition stays clear. If you enjoy layering, add a light citrus body wash beforehand—the bright top notes will feel even fresher without changing the base.

Why Choose Pierre Cardin Perfume?

Buy with confidence: authentic stock, competitive price, and free shipping at The Perfume Shop. That combination makes it simple to keep a dependable bottle on hand—or to gift a classic that most people enjoy.

FAQs

What does Pierre Cardin cologne smell like?

Pierre Cardin opens with lemon and other citrus-aromatic facets, moves into a heart of carnation and florals, then settles into vanilla and woods for a clean, wearable finish.

Is this Pierre Cardin cologne long-lasting?

Most wearers get about 6–8 hours from the EDT, with stronger presence early on; EDP versions, where offered, can last longer.

What fragrance notes are in Pierre Cardin?

Top: Lemon, Bergamot, Orange, Lavender, Basil. Heart: Carnation, Geranium, Leather, Sandalwood, Patchouli, Orris. Base: Vanilla, Moss, Tonka Bean, Leather, Benzoin, Amber.

Is Pierre Cardin cologne suitable for all occasions?

Yes. Apply lightly for daytime or office wear; add extra sprays for evenings or cooler weather.

Can Pierre Cardin be used by both men and women?

Fragrance is personal. Although this edition is categorized by audience in our store, anyone who enjoys the scent profile can wear it.

Where is the best place to shop Pierre Cardin cologne online?

For discounts, verified authenticity, and free shipping, the best place is The Perfume Shop.

What season is Pierre Cardin cologne best for?

It leans slightly cooler-weather due to its base, but the fresh opening keeps it wearable year-round.

Which variations are available (Eau de Toilette, Eau de Parfum)?

Availability can vary by region, but Eau de Toilette (EDT) is most common; select lines also offer Eau de Parfum (EDP) for longer wear.

Authenticity & Security

Authentic & Original Fragrances

At The Perfume Shop , we offer authentic fragrances. Every perfume, cologne, and beauty product listed on our website is sourced through established distributors and reputable wholesale partners. We focus on accurate product details, clear images, and barcodes/packaging information (where available), so you can shop with confidence.

Secure Shopping & Privacy

Your privacy and security are a top priority at The Perfume Shop USA. Our website uses SSL (Secure Socket Layer) encryption to protect your personal information such as your name, address, and payment details during checkout. This helps keep your data private and protected while you shop.

Shipping & Returns

1. Shipping & Return Questions

What is your shipping rates & policy?
Standard Shipping (USA)
  • Free for orders over $ 59.99, otherwise shipping is $ 5.99.
  • Orders to PO Box, HI, PR, AK, APO, FPO are shipped via USPS.
  • Ships via UPS, FedEx, or Postal Service.
  • Arrives in 3 - 5 business days.
  • Applicable sales tax is calculated at checkout based on your shipping address.

See Our Shipping Policy

2. Returns and Exchanges

Returns Policy

Easy returns within 30 days. If you would like to return a product from your order simply send the unopened product back to us in its original sealed packaging.

Refund Process & Timeline

Refunds are issued to the original payment method used at checkout.

Refunds are initiated as soon as we receive and inspect the returned item. Depending on your bank or payment provider, it may take 3 to 7 business days for the refund to appear on your statement.

Please contact with our support team for return queries. See Return Policy

Reviews

Customer Reviews

Based on 3 reviews
67%
(2)
33%
(1)
0%
(0)
0%
(0)
0%
(0)
S
Samuel

This is my go to fragrance and has been since I first used it, many, many years ago. LOVE it !

G
Gregory

I used it every day .I'm very satisfied . customer is awesome. Thank you perfumebids.com

A
Alexander

Just a few sprays each day and every body is saying, boy you smell good.

Buy More Save More Discount Offer - The Perfume Shop