Gucci-Bamboo-by-Gucci-For-Women
Gucci-Bamboo-by-Gucci-For-Women

Gucci Bamboo by Gucci For Women

$131.99 USD $122.99 USD SAVE 7%

Product Description:Immerse yourself in the luxurious and sophisticated aura of Gucci Bamboo by Gucci For Women. This exquisite fragrance, launched by the iconic fashion house, embodies the modern woman's strength, confidence,...

Size: Eau De Toilette Spray 2.5 ozSize Guide

Eau De Toilette Spray 2.5 oz
Eau De Parfum Spray 2.5 oz

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Gucci
SKU: 536520
Availability: In Stock Pre order Out of stock
sold in last hours
Order in the next [totalHours] hours %M minutes to get it between and
Product Description

Product Description:
Immerse yourself in the luxurious and sophisticated aura of Gucci Bamboo by Gucci For Women. This exquisite fragrance, launched by the iconic fashion house, embodies the modern woman's strength, confidence, and femininity. This beautifully designed bottle mirrors the brand’s renowned bamboo motif, this scent is a perfect fusion of elegance and resilience.
Brand Detail:
Gucci is a famous Italian brand offering men and women a wide range of luxury perfumes. The brand’s perfumes reflect elegance and sophistication. The brand offers a luxurious collection of perfumes to cater to different preferences and occasions. The brand is famous for designing seductive and contemporary scents. 

Use:
It is perfect to wear on casual office days and evening events.

Fragrance Family: Floral
Scent Type: Floral, woody, amber
Top Notes: Italian Bergamot, Orange Blossom
Heart Notes: Casablanca Lily, Ylang-Ylang
Base Notes: Sandalwood, Tahitian Vanilla, Ambergris
Ingredients: Alcohol Denat, Parfum (Fragrance), Aqua (Water), Ethylhexyl Methoxycinnamate, Diethylamino, Hydroxybenzoyl Hexyl Benzoate, BHT, Linalool, Limonene, Hydroxycitronellal, Geraniol, Hydroxyisohexyl, 3-Cyclohexene Carboxaldehyde, Alpha-Isomethyl Ionone, Benzyl Salicylate, Citral, Benzyl Benzoate, Farnesol, Citronellol, Isoeugenol, CI 60730 (Ext. Violet 2), CI 19140 (Yellow 5), CI 17200 (Red 33), CI 14700 (Red 4), 80% Volumen
Gender: Women

 

Brand Details

Gucci is a famous Italian brand offering men and women a wide range of luxury perfumes. The brand’s perfumes reflect elegance and sophistication. The brand offers a luxurious collection of perfumes to cater to different preferences and occasions. The brand is famous for designing seductive and contemporary scents. 

Reviews

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)