Gucci Bamboo by Gucci For Women - Eau De Toilette Spray 2.5 oz
Gucci Bamboo by Gucci For Women - Eau De Parfum Spray 1.6 oz
Gucci Bamboo by Gucci For Women - Eau De Parfum Spray 2.5 oz

Gucci Bamboo by Gucci For Women

$134.99 USD $119.99 USD SAVE 11%

Size: Eau De Toilette Spray 2.5 ozSize Guide (Oz to Ml)

Eau De Toilette Spray 2.5 oz
Eau De Parfum Spray 1.6 oz
Eau De Parfum Spray 2.5 oz

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Gucci
SKU: 536520
Barcode: 8005610295077
Availability: In Stock Pre order Out of stock
Add More to Cart, Save Upto 06% — Limited Time Offer
Product Description

Product Description:
Immerse yourself in the luxurious and sophisticated aura of Gucci Bamboo by Gucci For Women. This exquisite fragrance, launched by the iconic fashion house, embodies the modern woman's strength, confidence, and femininity. This beautifully designed bottle mirrors the brand’s renowned bamboo motif, this scent is a perfect fusion of elegance and resilience.
Brand Detail:
Gucci is a famous Italian brand offering men and women a wide range of luxury perfumes. The brand’s perfumes reflect elegance and sophistication. The brand offers a luxurious collection of perfumes to cater to different preferences and occasions. The brand is famous for designing seductive and contemporary scents. 

Use:
It is perfect to wear on casual office days and evening events.

Fragrance Family: Floral
Scent Type: Floral, woody, amber
Top Notes: Italian Bergamot, Orange Blossom
Heart Notes: Casablanca Lily, Ylang-Ylang
Base Notes: Sandalwood, Tahitian Vanilla, Ambergris
Ingredients: Alcohol Denat, Parfum (Fragrance), Aqua (Water), Ethylhexyl Methoxycinnamate, Diethylamino, Hydroxybenzoyl Hexyl Benzoate, BHT, Linalool, Limonene, Hydroxycitronellal, Geraniol, Hydroxyisohexyl, 3-Cyclohexene Carboxaldehyde, Alpha-Isomethyl Ionone, Benzyl Salicylate, Citral, Benzyl Benzoate, Farnesol, Citronellol, Isoeugenol, CI 60730 (Ext. Violet 2), CI 19140 (Yellow 5), CI 17200 (Red 33), CI 14700 (Red 4), 80% Volumen
Gender: Women

 

Authenticity & Security

Authentic & Original Fragrances

At The Perfume Shop , we offer authentic fragrances. Every perfume, cologne, and beauty product listed on our website is sourced through established distributors and reputable wholesale partners. We focus on accurate product details, clear images, and barcodes/packaging information (where available), so you can shop with confidence.

Secure Shopping & Privacy

Your privacy and security are a top priority at The Perfume Shop USA. Our website uses SSL (Secure Socket Layer) encryption to protect your personal information such as your name, address, and payment details during checkout. This helps keep your data private and protected while you shop.

Shipping & Returns

1. Shipping & Return Questions

What is your shipping rates & policy?
Standard Shipping (USA)
  • Free for orders over $ 59.99, otherwise shipping is $ 5.99.
  • Orders to PO Box, HI, PR, AK, APO, FPO are shipped via USPS.
  • Ships via UPS, FedEx, or Postal Service.
  • Arrives in 3 - 5 business days.
  • Applicable sales tax is calculated at checkout based on your shipping address.

See Our Shipping Policy

2. Returns and Exchanges

Returns Policy

Easy returns within 30 days. If you would like to return a product from your order simply send the unopened product back to the address below in its original sealed packaging. You can expect a refund within one billing cycle of our receiving your returned product. If shipping was free for your order it will be deducted from the credit we apply to your credit card. Please note, we do not accept returns for cosmetics and skincare items due to health reasons, please make your selections carefully. Shipping cost is non-refundable for undelivered, unclaimed, returned and refused packages, unless we made an error.

Please contact with our support team for return queries. See Return Policy

Reviews

Customer Reviews

Based on 8 reviews
75%
(6)
25%
(2)
0%
(0)
0%
(0)
0%
(0)
E
Emily
Love the smell

I love the smell I love people always asking what I wearing because I love to hug

L
Lily
Great value

Great value! Full bottle and great smelling! I would definitely buy again!

E
Eleanor
Love Gucci Bamboo

Love this product my favorite Gucci Bamboo

G
Gianna
Nice smell

Very nice smell and now all of our female friends are requesting this perfume!!!!

S
Scarlett
Very attractive

Love the attention i get from wearing the perfume.I will be purchasing more product

Buy More Save More Discount Offer - The Perfume Shop