Pi by Givenchy For Men - Eau De Toilette Spray 1.7 oz
Pi by Givenchy For Men - Eau De Toilette Spray 3.3 oz
Pi by Givenchy For Men - Eau De Toilette Spray (Tester) 3.4 oz
Pi-by-Givenchy-For-Men-Travel-Spray-0.27-oz

Pi by Givenchy For Men

$52.99 USD $44.99 USD SAVE 15%

Size: Eau De Toilette Spray 1.7 ozSize Guide (Oz to Ml)

Eau De Toilette Spray 1.7 oz
Eau De Toilette Spray 3.3 oz

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Givenchy
SKU: 400595
Barcode: 3274872395497
Availability: In Stock Pre order Out of stock
Add More to Cart, Save Upto 06% — Limited Time Offer
Product Description

About Pi Perfume For Men

Launched in 1998, Pi is a cologne from Givenchy, created by perfumer Alberto Morillas, that leans amber-woody with benzoin and vanilla facets.

It comes in a angular bottle designed by Serge Mansau featuring the π motif; wears well for office hours, casual days and evening plans; balancing a fresh opening with a refined fragrance dry‑down; making this cologne a practical choice for shoppers who want an everyday scent without heaviness.

Pi Fragrance Profile & Notes

  • Top Notes: Mandarin Orange, Tarragon, Rosemary, Basil
  • Heart Notes: Anise, Neroli, Geranium, Lily-of-the-Valley
  • Base Notes: Vanilla, Almond, Tonka Bean, Benzoin, Cedar

The opening brings bright citrus, aromatic herbs and spice that flows into a balanced heart for a clean, modern character. It dries down to soft woods, amber warmth, vanillic sweetness, making this fragrance easy to wear daily and versatile across seasons.

Performance & Longevity of Pi Perfume

On normal skin, the Eau de Toilette (EDT) concentration usually gives around 6–8 hours. Projection starts noticeable for the first 90 minutes and then settles to a personal scent bubble. If an Eau de Parfum (EDP) exists for this line, expect denser mid‑notes and an extra 1–2 hours of wear.

Season & setting: the fresh opening works during spring and summer days; the woody or amber base is well suited to autumn evenings. It handles casual plans, office use, and dinner plans with equal ease. Spraying once on a scarf or jacket can extend the trail without overdoing it.

Application tips: spray 3–4 times from 10–15 cm. Focus on pulse points (sides of neck, upper chest). For longer wear, lightly mist clothing from a distance; avoid delicate fabrics. If you have dry skin, urize first to help the scent last longer.

Care: store the bottle away from heat and direct sun. Proper storage preserves the color and the brightness of the top notes so the fragrance stays true from first to last spray.

Usage & pairing: pairs well with simple grooming products (unscented deodorant, mild aftershave balm) so the composition stays clear. If you enjoy layering, add a light citrus body wash beforehand—the bright top notes will feel even fresher without changing the base.

Why Choose Pi Perfume?

Buy with confidence: authentic stock, competitive price, and free shipping at The Perfume Shop. That combination makes it simple to keep a dependable bottle on hand—or to gift a classic that most people enjoy.

FAQs

What does Pi cologne smell like?

Pi opens with mandarin orange and other citrus-aromatic facets, moves into a heart of anise and florals, then settles into vanilla and woods for a clean, wearable finish.

Is this Pi cologne long-lasting?

Most wearers get about 6–8 hours from the EDT, with stronger presence early on; EDP versions, where offered, can last longer.

What fragrance notes are in Pi?

Top: Mandarin Orange, Tarragon, Rosemary, Basil. Heart: Anise, Neroli, Geranium, Lily-of-the-Valley. Base: Vanilla, Almond, Tonka Bean, Benzoin, Cedar.

Is Pi cologne suitable for all occasions?

Yes. Apply lightly for daytime or office wear; add extra sprays for evenings or cooler weather.

Can Pi be used by both men and women?

Fragrance is personal. Although this edition is categorized by audience in our store, anyone who enjoys the scent profile can wear it.

Where is the best place to shop Pi cologne online?

For discounts, verified authenticity, and free shipping, the best place is The Perfume Shop.

What season is Pi cologne best for?

It leans slightly cooler-weather due to its base, but the fresh opening keeps it wearable year-round.

Which variations are available (Eau de Toilette, Eau de Parfum)?

Availability can vary by region, but Eau de Toilette (EDT) is most common; select lines also offer Eau de Parfum (EDP) for longer wear.

Authenticity & Security

Authentic & Original Fragrances

At The Perfume Shop , we offer authentic fragrances. Every perfume, cologne, and beauty product listed on our website is sourced through established distributors and reputable wholesale partners. We focus on accurate product details, clear images, and barcodes/packaging information (where available), so you can shop with confidence.

Secure Shopping & Privacy

Your privacy and security are a top priority at The Perfume Shop USA. Our website uses SSL (Secure Socket Layer) encryption to protect your personal information such as your name, address, and payment details during checkout. This helps keep your data private and protected while you shop.

Shipping & Returns

1. Shipping & Return Questions

What is your shipping rates & policy?
Standard Ground (USA)
  • Free for orders over $ 59.99, otherwise shipping is $ 5.99.
  • Orders to PO Box, HI, PR, AK, APO, FPO are shipped via USPS.
  • Ships via UPS, FedEx, or Postal Service.
  • Arrives in 3 - 5 business days.

2. Returns and Exchanges

Returns Policy

Easy returns within 30 days. If you would like to return a product from your order simply send the unopened product back to the address below in its original sealed packaging. You can expect a refund within one billing cycle of our receiving your returned product. If shipping was free for your order it will be deducted from the credit we apply to your credit card. Please note, we do not accept returns for cosmetics and skincare items due to health reasons, please make your selections carefully. Shipping cost is non-refundable for undelivered, unclaimed, returned and refused packages, unless we made an error.

Please contact with our support team for return queries. See Return Policy

Buying Tips

What’s the difference between Perfume, Eau de Parfum, Eau de Toilette and Cologne?

  • Perfume (Parfum/Extrait) highest oil about 15-30% with richest scent and longest wear using few sprays.
  • Eau de Parfum (EDP) mid to high oil about 10-15% offering long-lasting balanced wear for daily use.
  • Eau de Toilette (EDT) medium to light oil about 5-20% lighter projection and easy to reapply.
  • Cologne (EdC) light oil about 2-5% fresh feel and shorter wear for quick refreshes.

How should I store my fragrance?

Keep bottles sealed, in a cool, dry, dark place, ideally inside their boxes, to help them last longer.

Reviews

Customer Reviews

Based on 7 reviews
71%
(5)
29%
(2)
0%
(0)
0%
(0)
0%
(0)
M
Michael
Purchased for my son,

Purchased for my son, he absolutely loved it!

M
Megan
I use this every day

I use this every day and love it!

S
Steven
He wears it everyday.

He wears it everyday. Loves it.

J
Joe
Love it

Love it but it smells better on my husband!

D
Daniel
Just absolutely love the smell

Just absolutely love the smell and how long it lasts

Buy More Save More Discount Offer - The Perfume Shop