Perry Ellis Reserve by Perry Ellis For Body Lotion 8 oz

Perry Ellis Reserve by Perry Ellis-Body Lotion 8 oz

$19.99 USD

Reserve for Women gives a sense of total harmony, achieved with a blend of soft floralcy, exotic woods and sensuous, warm notes. As the fragrance unfolds, Mid Notes of yellow Freesia,...

Size: Body Lotion 8 ozSize Guide

Body Lotion 8 oz

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Perry Ellis
SKU: 551306
Availability: In Stock Pre order Out of stock
Categories: Body Lotion
sold in last hours
Order in the next [totalHours] hours %M minutes to get it between and
Product Description

Reserve for Women gives a sense of total harmony, achieved with a blend of soft floralcy, exotic woods and sensuous, warm notes. As the fragrance unfolds, Mid Notes of yellow Freesia, Marigold, Lotus Blossom, White Violet and Night Blooming Lily are introduced.

Reviews

Customer Reviews

Based on 1 review
100%
(1)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
A
Aspen
Highly recommended

It absorbs quickly and does not leave a greasy residue.I highly recommend this product to anyone looking for a natural and effective lotion.