Perry Ellis Reserve by Perry Ellis For Body Lotion 8 oz

Perry Ellis Reserve by Perry Ellis-Body Lotion 8 oz

$19.99 USD

Size: Body Lotion 8 ozSize Guide (Oz to Ml)

Body Lotion 8 oz

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Perry Ellis
SKU: 551306
Availability: In Stock Pre order Out of stock
Add More to Cart, Save Upto 06% β€” Limited Time Offer
Product Description

Reserve for Women gives a sense of total harmony, achieved with a blend of soft floralcy, exotic woods and sensuous, warm notes. As the fragrance unfolds, Mid Notes of yellow Freesia, Marigold, Lotus Blossom, White Violet and Night Blooming Lily are introduced.

Authenticity & Security

100% Authentic & Genuine Fragrances – Guaranteed

At The Perfume Shop , we take pride in offering only 100% original brand-name fragrances. Every perfume, cologne, and beauty product featured in our store is authentic and sourced directly from trusted brands and suppliers. We never sell imitations, knock-offs, or counterfeit productsβ€”only genuine designer fragrances at unbeatable prices. Shop with confidence, knowing you’re getting the real deal, every time.

Our Security Commitment

At The Perfume Shop USA, we prioritize your safety and privacy to ensure a secure and worry-free shopping experience. Our advanced security measures protect every transaction, giving you complete peace of mind while you shop.

We use Secure Server Software (SSL) encryption to safeguard your personal information, including your name, address, and payment details. This ensures that your data remains private and protected from unauthorized access. Shop with confidence, knowing that your security is our top priority.

Shipping & Returns

1. Shipping & Return Questions

What is your shipping rates & policy?
Standard Ground (USA)
  • Free for orders over $ 59.99, otherwise shipping is $ 5.99.
  • Orders to PO Box, HI, PR, AK, APO, FPO are shipped via USPS.
  • Ships via UPS, FedEx, or Postal Service.
  • Arrives in 2 - 5 business days.
2nd Day Air (USA)
  • Starts at $12.95
  • Arrives in 2 – 3 business days
  • Ships via UPS, FedEx, or Postal Service
  • (not available for P.O. Boxes)
Standard Ground (UK)
  • Complimentary ground shipping within 3 to 7 business days (UK).
  • Free for orders over Β£ 99.99, otherwise shipping is Β£ 5.99.
    Ships via Fedex, DHL, UPS, USPS,Β DPDΒ and other local carriers
  • You will NOT be charged any additional fees when you receive your package.

2. Returns and Exchanges

Returns Policy

Easy and complimentary, within 30 days. If you would like to return a product from your order simply send the unopened product back to the address below in its original sealed packaging. You can expect a refund within one billing cycle of our receiving your returned product. If shipping was free for your order it will be deducted from the credit we apply to your credit card. Please note, we do not accept returns for cosmetics and skincare items due to health reasons, please make your selections carefully. Shipping cost is non-refundable for undelivered, unclaimed, returned and refused packages, unless we made an error.

Please contact with our support team for return queries.Email:contact@theperfumeshopusa.com

Buying Tips

What’s the difference between Perfume, Eau de Parfum, Eau de Toilette and Cologne?

  • Perfume (Parfum/Extrait) highest oil about 15-30% with richest scent and longest wear using few sprays.
  • Eau de Parfum (EDP) mid to high oil about 10-15% offering long-lasting balanced wear for daily use.
  • Eau de Toilette (EDT) medium to light oil about 5-20% lighter projection and easy to reapply.
  • Cologne (EdC) light oil about 2-5% fresh feel and shorter wear for quick refreshes.

What’s the difference between Mini Travel Sprays & Samples (Vials)?

  • Travel Sprays (Mini) portable spray sizes for travel or gym with easy reapplication and try before you buy flexibility.
  • Sample (Vials) small testers to wear on skin over time so you can choose the right scent before a full bottle.

Are Tester bottles authentic?

Yes, testers are 100% authentic and full; they often ship in plain packaging and may arrive without a cap, hence the lower price.

How should I store my fragrance?

Keep bottles sealed, in a cool, dry, dark place, ideally inside their boxes, to help them last up to about three years.

Reviews

Customer Reviews

Based on 1 review
100%
(1)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
A
Aspen
Highly recommended

It absorbs quickly and does not leave a greasy residue.I highly recommend this product to anyone looking for a natural and effective lotion.

Buy More Save More Discount Offer - The Perfume Shop