Perry Ellis Reserve by Perry Ellis For Body Lotion 8 oz

Perry Ellis Reserve by Perry Ellis-Body Lotion 8 oz

$19.99 USD

Size: Body Lotion 8 ozSize Guide

Body Lotion 8 oz

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Perry Ellis
SKU: 551306
Availability: In Stock Pre order Out of stock
Categories: Body Lotion
sold in last hours
Order in the next [totalHours] hours %M minutes to get it between and
Product Description

Reserve for Women gives a sense of total harmony, achieved with a blend of soft floralcy, exotic woods and sensuous, warm notes. As the fragrance unfolds, Mid Notes of yellow Freesia, Marigold, Lotus Blossom, White Violet and Night Blooming Lily are introduced.

Authenticity & Security

100% Authentic & Genuine Fragrances – Guaranteed

At The Perfume Shop USA, we take pride in offering only 100% original brand-name fragrances. Every perfume, cologne, and beauty product featured in our store is authentic and sourced directly from trusted brands and suppliers. We never sell imitations, knock-offs, or counterfeit products—only genuine designer fragrances at unbeatable prices. Shop with confidence, knowing you’re getting the real deal, every time.

Our Security Commitment

At The Perfume Shop USA, we prioritize your safety and privacy to ensure a secure and worry-free shopping experience. Our advanced security measures protect every transaction, giving you complete peace of mind while you shop.

We use Secure Server Software (SSL) encryption to safeguard your personal information, including your name, address, and payment details. This ensures that your data remains private and protected from unauthorized access. Shop with confidence, knowing that your security is our top priority.

Shipping & Returns

1. Shipping & Return Questions

What is your shipping rates & policy?
Standard Ground (USA)
  • Free for orders over $ 59.99, otherwise shipping is $ 5.99.
  • Orders to PO Box, HI, PR, AK, APO, FPO are shipped via USPS.
  • Ships via UPS, FedEx, or Postal Service.
  • Arrives in 2 - 5 business days.
  • Starts at $12.95
  • Arrives in 2 – 3 business days
  • Ships via UPS, FedEx, or Postal Service
  • (not available for P.O. Boxes)
Standard Ground (UK)
  • Complimentary ground shipping within 1 to 8 business days (UK).
  • Free for orders over £ 99.99, otherwise shipping is £ 8.99.
    Ships via Fedex, DHL, UPS, USPS, DPD and other local carriers
Canada
  • Ships via Postal Service for $ 15.99 (CAD).  Arrives in 3 - 10 business days.
  • Canada orders arrive by local post or UPS directly to your door. 
United Arab Emirates 
  • Ships via Postal Service for $ 16.99.
  • Arrives in 3 - 10 business days.
Australia
  • Ships via Postal Service for $ 16.99 (AUD). 
  • Arrives in 3 - 10 business days.

Worldwide Shipping (Shipping costs range depending on your location. Orders typically take 4-15 business days) Ships via Fedex, DHL, UPS, USPS, DPD and other local carriers from $ 4.99 + $ 0.99 per item depending on your country Arrives in 4 - 12 business days with tracking.

2. Returns and Exchanges

Returns Policy

Easy and complimentary, within 14 daysIf you would like to return a product from your order simply send the unopened product back to the address below in its original sealed packaging. You can expect a refund within one billing cycle of our receiving your returned product. If shipping was free for your order it will be deducted from the credit we apply to your credit card. Please note, we do not accept returns for cosmetics and skincare items due to health reasons, please make your selections carefully. Shipping cost is non-refundable for undelivered, unclaimed, returned and refused packages, unless we made an error.Returns Should be sent to :

The Perfume Shop
5065 Main St Suite 189Trumbull CT 06611, USA.

Please contact with our support team for return queries.Email:contact@theperfumeshopusa.com

Reviews

Customer Reviews

Based on 1 review
100%
(1)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
A
Aspen
Highly recommended

It absorbs quickly and does not leave a greasy residue.I highly recommend this product to anyone looking for a natural and effective lotion.