Coach-Poppy-by-Coach-For-Women-Eau-De-Parfum-Spray-1-oz
Coach-Poppy-by-Coach-For-Women-Eau-De-Parfum-Spray-3.4-oz

Coach Poppy by Coach For Women

$94.99 USD $51.99 USD SAVE 45%

Size: Eau De Parfum Spray 1 ozSize Guide (Oz to Ml)

Eau De Parfum Spray 1 oz
Eau De Parfum Spray 3.4 oz

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Coach
SKU: 501859
Availability: In Stock Pre order Out of stock
sold in last hours
Order in the next [totalHours] hours %M minutes to get it between and
Add More to Cart, Save Upto 06% — Limited Time Offer
Product Description

Coach Poppy by Coach For Women is a delightful and exuberant fragrance to captures the youthful spirit and vibrant energy of the modern woman. This perfume exudes a playful and feminine charm, perfect for any occasion. Coach Poppy is a must-have addition to any fragrance collection housed in a stylish and elegant bottle adorned with a playful poppy motif.

Band Detail:

Coach is a renowned American luxury fashion brand established in 1941. It is known for its exceptional craftsmanship and innovative design. Coach has become synonymous with effortless New York style and sophisticated elegance. Coach continues to set the standard for modern luxury, offering a wide range of high-end fragrances that appeal to a global audience.

Uses:

It is perfect to wear at daily adventures, date nights, and parties. 

Fragrance Family: Fruity
Top Notes: fresh cucumber, juicy mandarin, and freesia
Heart Notes: jasmine, pink water lily, Southern gardenia, red candied rose petals
Base Notes:  creamy vanilla, whipped marshmallow, musk, sandalwood
Gender: Women
Ingredients: Water, Alcohol Denatured, Limonene, Linalool.
Authenticity & Security

100% Authentic & Genuine Fragrances – Guaranteed

At The Perfume Shop , we take pride in offering only 100% original brand-name fragrances. Every perfume, cologne, and beauty product featured in our store is authentic and sourced directly from trusted brands and suppliers. We never sell imitations, knock-offs, or counterfeit products—only genuine designer fragrances at unbeatable prices. Shop with confidence, knowing you’re getting the real deal, every time.

Our Security Commitment

At The Perfume Shop USA, we prioritize your safety and privacy to ensure a secure and worry-free shopping experience. Our advanced security measures protect every transaction, giving you complete peace of mind while you shop.

We use Secure Server Software (SSL) encryption to safeguard your personal information, including your name, address, and payment details. This ensures that your data remains private and protected from unauthorized access. Shop with confidence, knowing that your security is our top priority.

Shipping & Returns

1. Shipping & Return Questions

What is your shipping rates & policy?
Standard Ground (USA)
  • Free for orders over $ 59.99, otherwise shipping is $ 5.99.
  • Orders to PO Box, HI, PR, AK, APO, FPO are shipped via USPS.
  • Ships via UPS, FedEx, or Postal Service.
  • Arrives in 2 - 5 business days.
2nd Day Air (USA)
  • Starts at $12.95
  • Arrives in 2 – 3 business days
  • Ships via UPS, FedEx, or Postal Service
  • (not available for P.O. Boxes)
Standard Ground (UK)
  • Complimentary ground shipping within 3 to 7 business days (UK).
  • Free for orders over £ 99.99, otherwise shipping is £ 5.99.
    Ships via Fedex, DHL, UPS, USPS, DPD and other local carriers
  • You will NOT be charged any additional fees when you receive your package.

2. Returns and Exchanges

Returns Policy

Easy and complimentary, within 30 days. If you would like to return a product from your order simply send the unopened product back to the address below in its original sealed packaging. You can expect a refund within one billing cycle of our receiving your returned product. If shipping was free for your order it will be deducted from the credit we apply to your credit card. Please note, we do not accept returns for cosmetics and skincare items due to health reasons, please make your selections carefully. Shipping cost is non-refundable for undelivered, unclaimed, returned and refused packages, unless we made an error.

Please contact with our support team for return queries.Email:contact@theperfumeshopusa.com

Buying Tips

What’s the difference between Perfume, Eau de Parfum, Eau de Toilette and Cologne?

  • Perfume (Parfum/Extrait) highest oil about 15-30% with richest scent and longest wear using few sprays.
  • Eau de Parfum (EDP) mid to high oil about 10-15% offering long-lasting balanced wear for daily use.
  • Eau de Toilette (EDT) medium to light oil about 5-20% lighter projection and easy to reapply.
  • Cologne (EdC) light oil about 2-5% fresh feel and shorter wear for quick refreshes.

What’s the difference between Mini Travel Sprays & Samples (Vials)?

  • Travel Sprays (Mini) portable spray sizes for travel or gym with easy reapplication and try before you buy flexibility.
  • Sample (Vials) small testers to wear on skin over time so you can choose the right scent before a full bottle.

Are Tester bottles authentic?

Yes, testers are 100% authentic and full; they often ship in plain packaging and may arrive without a cap, hence the lower price.

How should I store my fragrance?

Keep bottles sealed, in a cool, dry, dark place, ideally inside their boxes, to help them last up to about three years.

Reviews

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Buy More Save More Discount Offer - The Perfume Shop