Coach-Poppy-by-Coach-For-Women-Eau-De-Parfum-Spray-1-oz
-24%

Coach Poppy by Coach For Women

$62.99 USD $47.99 USD SAVE 24%

Size: Eau De Parfum Spray 1 ozSize Guide

Eau De Parfum Spray 1 oz
 More payment options
Buy more and saveDon't miss out on these amazing deals!
Most Popular
Buy 2
Save 3%
$95.98
$93.10
Item 1
Item 2
Best Deal
Buy 3
Save 6%
$143.97
$135.33
Item 1
Item 2
Item 3

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Coach
SKU: 501859
Availability: In Stock
6 sold in last 14 hours
Order in the next 1 hours 55 minutes to get it between Monday, 12th May and Tuesday, 13th May
Product Description

Coach Poppy by Coach For Women is a delightful and exuberant fragrance to captures the youthful spirit and vibrant energy of the modern woman. This perfume exudes a playful and feminine charm, perfect for any occasion. Coach Poppy is a must-have addition to any fragrance collection housed in a stylish and elegant bottle adorned with a playful poppy motif.

Band Detail:

Coach is a renowned American luxury fashion brand established in 1941. It is known for its exceptional craftsmanship and innovative design. Coach has become synonymous with effortless New York style and sophisticated elegance. Coach continues to set the standard for modern luxury, offering a wide range of high-end fragrances that appeal to a global audience.

Uses:

It is perfect to wear at daily adventures, date nights, and parties. 

Fragrance Family: Fruity
Top Notes: fresh cucumber, juicy mandarin, and freesia
Heart Notes: jasmine, pink water lily, Southern gardenia, red candied rose petals
Base Notes:  creamy vanilla, whipped marshmallow, musk, sandalwood
Gender: Women
Ingredients: Water, Alcohol Denatured, Limonene, Linalool.
Authenticity & Security

100% Authentic & Genuine Fragrances – Guaranteed

At The Perfume Shop USA, we take pride in offering only 100% original brand-name fragrances. Every perfume, cologne, and beauty product featured in our store is authentic and sourced directly from trusted brands and suppliers. We never sell imitations, knock-offs, or counterfeit products—only genuine designer fragrances at unbeatable prices. Shop with confidence, knowing you’re getting the real deal, every time.

Our Security Commitment

At The Perfume Shop USA, we prioritize your safety and privacy to ensure a secure and worry-free shopping experience. Our advanced security measures protect every transaction, giving you complete peace of mind while you shop.

We use Secure Server Software (SSL) encryption to safeguard your personal information, including your name, address, and payment details. This ensures that your data remains private and protected from unauthorized access. Shop with confidence, knowing that your security is our top priority.

Shipping & Returns

1. Shipping & Return Questions

What is your shipping rates & policy?
Standard Ground (USA)
  • Free for orders over $ 59.99, otherwise shipping is $ 5.99.
  • Orders to PO Box, HI, PR, AK, APO, FPO are shipped via USPS.
  • Ships via UPS, FedEx, or Postal Service.
  • Arrives in 2 - 5 business days.
  • Starts at $12.95
  • Arrives in 2 – 3 business days
  • Ships via UPS, FedEx, or Postal Service
  • (not available for P.O. Boxes)
Standard Ground (UK)
  • Complimentary ground shipping within 1 to 8 business days (UK).
  • Free for orders over £ 99.99, otherwise shipping is £ 8.99.
    Ships via Fedex, DHL, UPS, USPS, DPD and other local carriers
Canada
  • Ships via Postal Service for $ 15.99 (CAD).  Arrives in 3 - 10 business days.
  • Canada orders arrive by local post or UPS directly to your door. 
United Arab Emirates 
  • Ships via Postal Service for $ 16.99.
  • Arrives in 3 - 10 business days.
Australia
  • Ships via Postal Service for $ 16.99 (AUD). 
  • Arrives in 3 - 10 business days.

Worldwide Shipping (Shipping costs range depending on your location. Orders typically take 4-15 business days) Ships via Fedex, DHL, UPS, USPS, DPD and other local carriers from $ 4.99 + $ 0.99 per item depending on your country Arrives in 4 - 12 business days with tracking.

2. Returns and Exchanges

Returns Policy

Easy and complimentary, within 14 daysIf you would like to return a product from your order simply send the unopened product back to the address below in its original sealed packaging. You can expect a refund within one billing cycle of our receiving your returned product. If shipping was free for your order it will be deducted from the credit we apply to your credit card. Please note, we do not accept returns for cosmetics and skincare items due to health reasons, please make your selections carefully. Shipping cost is non-refundable for undelivered, unclaimed, returned and refused packages, unless we made an error.Returns Should be sent to :

The Perfume Shop
5065 Main St Suite 189Trumbull CT 06611, USA.

Please contact with our support team for return queries.Email:contact@theperfumeshopusa.com

Reviews

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)