Pierre-Cardin-by-Pierre-Cardin-For-Men-Cologne/Eau-De-Toilette-Spray-2.8-oz
Pierre-Cardin-by-Pierre-Cardin-For-Men-Body-Spray-6-oz
Pierre-Cardin-by-Pierre-Cardin-For-Men-Cologne-/-Eau-De-Toilette-Spray-8-oz

Pierre Cardin by Pierre Cardin For Men

$80.99 USD $35.99 USD SAVE 56%

Size: Cologne/Eau De Toilette Spray 2.8 ozSize Guide (Oz to Ml)

Cologne/Eau De Toilette Spray 2.8 oz
Body Spray 6 oz
Cologne / Eau De Toilette Spray 8 oz

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
SKU: 400620
Availability: In Stock Pre order Out of stock
sold in last hours
Order in the next [totalHours] hours %M minutes to get it between and
Add More to Cart, Save Upto 06% — Limited Time Offer
Product Description

About Pierre Cardin Perfume For Men

Launched in 1998, Pierre Cardin is a cologne from Pierre Cardin, created by perfumer Alberto Morillas, that leans amber-woody with benzoin and vanilla facets.

It comes in a angular bottle designed by Serge Mansau featuring the π motif; wears well for office hours, casual days and evening plans; balancing a fresh opening with a refined fragrance dry‑down; making this cologne a practical choice for shoppers who want an everyday scent without heaviness.

Pierre Cardin Fragrance Profile & Notes

  • Top Notes: Lemon, Bergamot, Orange, Lavender, Basil
  • Heart Notes: Carnation, Geranium, Leather, Sandalwood, Patchouli, Orris
  • Base Notes: Vanilla, Moss, Tonka Bean, Leather, Benzoin, Amber

The opening brings bright citrus, aromatic herbs and spice that flows into a balanced heart for a clean, modern character. It dries down to amber warmth, earthy mossy trail, vanillic sweetness, subtle leather, making this fragrance easy to wear daily and versatile across seasons.

Performance & Longevity of Pierre Cardin Perfume

On normal skin, the Eau de Toilette (EDT) concentration usually gives around 6–8 hours. Projection starts noticeable for the first 90 minutes and then settles to a personal scent bubble. If an Eau de Parfum (EDP) exists for this line, expect denser mid‑notes and an extra 1–2 hours of wear.

Season & setting: the fresh opening works during spring and summer days; the woody or amber base is well suited to autumn evenings. It handles casual plans, office use, and dinner plans with equal ease. Spraying once on a scarf or jacket can extend the trail without overdoing it.

Application tips: spray 3–4 times from 10–15 cm. Focus on pulse points (sides of neck, upper chest). For longer wear, lightly mist clothing from a distance; avoid delicate fabrics. If you have dry skin, urize first to help the scent last longer.

Care: store the bottle away from heat and direct sun. Proper storage preserves the color and the brightness of the top notes so the fragrance stays true from first to last spray.

Usage & pairing: pairs well with simple grooming products (unscented deodorant, mild aftershave balm) so the composition stays clear. If you enjoy layering, add a light citrus body wash beforehand—the bright top notes will feel even fresher without changing the base.

Why Choose Pierre Cardin Perfume?

Buy with confidence: authentic stock, competitive price, and free shipping at The Perfume Shop. That combination makes it simple to keep a dependable bottle on hand—or to gift a classic that most people enjoy.

FAQs

What does Pierre Cardin cologne smell like?

Pierre Cardin opens with lemon and other citrus-aromatic facets, moves into a heart of carnation and florals, then settles into vanilla and woods for a clean, wearable finish.

Is this Pierre Cardin cologne long-lasting?

Most wearers get about 6–8 hours from the EDT, with stronger presence early on; EDP versions, where offered, can last longer.

What fragrance notes are in Pierre Cardin?

Top: Lemon, Bergamot, Orange, Lavender, Basil. Heart: Carnation, Geranium, Leather, Sandalwood, Patchouli, Orris. Base: Vanilla, Moss, Tonka Bean, Leather, Benzoin, Amber.

Is Pierre Cardin cologne suitable for all occasions?

Yes. Apply lightly for daytime or office wear; add extra sprays for evenings or cooler weather.

Can Pierre Cardin be used by both men and women?

Fragrance is personal. Although this edition is categorized by audience in our store, anyone who enjoys the scent profile can wear it.

Where is the best place to shop Pierre Cardin cologne online?

For discounts, verified authenticity, and free shipping, the best place is The Perfume Shop.

What season is Pierre Cardin cologne best for?

It leans slightly cooler-weather due to its base, but the fresh opening keeps it wearable year-round.

Which variations are available (Eau de Toilette, Eau de Parfum)?

Availability can vary by region, but Eau de Toilette (EDT) is most common; select lines also offer Eau de Parfum (EDP) for longer wear.

Authenticity & Security

100% Authentic & Genuine Fragrances – Guaranteed

At The Perfume Shop , we take pride in offering only 100% original brand-name fragrances. Every perfume, cologne, and beauty product featured in our store is authentic and sourced directly from trusted brands and suppliers. We never sell imitations, knock-offs, or counterfeit products—only genuine designer fragrances at unbeatable prices. Shop with confidence, knowing you’re getting the real deal, every time.

Our Security Commitment

At The Perfume Shop USA, we prioritize your safety and privacy to ensure a secure and worry-free shopping experience. Our advanced security measures protect every transaction, giving you complete peace of mind while you shop.

We use Secure Server Software (SSL) encryption to safeguard your personal information, including your name, address, and payment details. This ensures that your data remains private and protected from unauthorized access. Shop with confidence, knowing that your security is our top priority.

Shipping & Returns

1. Shipping & Return Questions

What is your shipping rates & policy?
Standard Ground (USA)
  • Free for orders over $ 59.99, otherwise shipping is $ 5.99.
  • Orders to PO Box, HI, PR, AK, APO, FPO are shipped via USPS.
  • Ships via UPS, FedEx, or Postal Service.
  • Arrives in 2 - 5 business days.
2nd Day Air (USA)
  • Starts at $12.95
  • Arrives in 2 – 3 business days
  • Ships via UPS, FedEx, or Postal Service
  • (not available for P.O. Boxes)
Standard Ground (UK)
  • Complimentary ground shipping within 3 to 7 business days (UK).
  • Free for orders over £ 99.99, otherwise shipping is £ 5.99.
    Ships via Fedex, DHL, UPS, USPS, DPD and other local carriers
  • You will NOT be charged any additional fees when you receive your package.

2. Returns and Exchanges

Returns Policy

Easy and complimentary, within 30 days. If you would like to return a product from your order simply send the unopened product back to the address below in its original sealed packaging. You can expect a refund within one billing cycle of our receiving your returned product. If shipping was free for your order it will be deducted from the credit we apply to your credit card. Please note, we do not accept returns for cosmetics and skincare items due to health reasons, please make your selections carefully. Shipping cost is non-refundable for undelivered, unclaimed, returned and refused packages, unless we made an error.

Please contact with our support team for return queries.Email:contact@theperfumeshopusa.com

Buying Tips

What’s the difference between Perfume, Eau de Parfum, Eau de Toilette and Cologne?

  • Perfume (Parfum/Extrait) highest oil about 15-30% with richest scent and longest wear using few sprays.
  • Eau de Parfum (EDP) mid to high oil about 10-15% offering long-lasting balanced wear for daily use.
  • Eau de Toilette (EDT) medium to light oil about 5-20% lighter projection and easy to reapply.
  • Cologne (EdC) light oil about 2-5% fresh feel and shorter wear for quick refreshes.

What’s the difference between Mini Travel Sprays & Samples (Vials)?

  • Travel Sprays (Mini) portable spray sizes for travel or gym with easy reapplication and try before you buy flexibility.
  • Sample (Vials) small testers to wear on skin over time so you can choose the right scent before a full bottle.

Are Tester bottles authentic?

Yes, testers are 100% authentic and full; they often ship in plain packaging and may arrive without a cap, hence the lower price.

How should I store my fragrance?

Keep bottles sealed, in a cool, dry, dark place, ideally inside their boxes, to help them last up to about three years.

Reviews

Customer Reviews

Based on 3 reviews
67%
(2)
33%
(1)
0%
(0)
0%
(0)
0%
(0)
S
Samuel

This is my go to fragrance and has been since I first used it, many, many years ago. LOVE it !

G
Gregory

I used it every day .I'm very satisfied . customer is awesome. Thank you perfumebids.com

A
Alexander

Just a few sprays each day and every body is saying, boy you smell good.

Buy More Save More Discount Offer - The Perfume Shop