Gucci-Bamboo-by-Gucci-For-Women-Eau-De-Toilette-Spray-2.5-oz
Gucci-Bamboo-by-Gucci-For-Women-Eau-De-Parfum-Spray-(Tester)-2.5-oz
-11%

Gucci Bamboo by Gucci For Women

$134.99 USD $119.99 USD SAVE 11%

Size: Eau De Toilette Spray 2.5 ozSize Guide

Eau De Toilette Spray 2.5 oz
Eau De Parfum Spray (Tester) 2.5 oz
Eau De Parfum Spray 1.6 oz
Eau De Parfum Spray 2.5 oz
 More payment options
Buy more and saveDon't miss out on these amazing deals!
Most Popular
Buy 2
Save 3%
$41.98
$40.72
Item 1
Item 2
Best Deal
Buy 3
Save 6%
$62.97
$59.19
Item 1
Item 2
Item 3
4 interest-free payments or as low as $10/mo with . Check your purchasing power

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Gucci
SKU: 536520
Availability: In Stock
9 sold in last 11 hours
Order in the next 2 hours 50 minutes to get it between Tuesday, 15th April and Friday, 18th April
Product Description

Product Description:
Immerse yourself in the luxurious and sophisticated aura of Gucci Bamboo by Gucci For Women. This exquisite fragrance, launched by the iconic fashion house, embodies the modern woman's strength, confidence, and femininity. This beautifully designed bottle mirrors the brand’s renowned bamboo motif, this scent is a perfect fusion of elegance and resilience.
Brand Detail:
Gucci is a famous Italian brand offering men and women a wide range of luxury perfumes. The brand’s perfumes reflect elegance and sophistication. The brand offers a luxurious collection of perfumes to cater to different preferences and occasions. The brand is famous for designing seductive and contemporary scents. 

Use:
It is perfect to wear on casual office days and evening events.

Fragrance Family: Floral
Scent Type: Floral, woody, amber
Top Notes: Italian Bergamot, Orange Blossom
Heart Notes: Casablanca Lily, Ylang-Ylang
Base Notes: Sandalwood, Tahitian Vanilla, Ambergris
Ingredients: Alcohol Denat, Parfum (Fragrance), Aqua (Water), Ethylhexyl Methoxycinnamate, Diethylamino, Hydroxybenzoyl Hexyl Benzoate, BHT, Linalool, Limonene, Hydroxycitronellal, Geraniol, Hydroxyisohexyl, 3-Cyclohexene Carboxaldehyde, Alpha-Isomethyl Ionone, Benzyl Salicylate, Citral, Benzyl Benzoate, Farnesol, Citronellol, Isoeugenol, CI 60730 (Ext. Violet 2), CI 19140 (Yellow 5), CI 17200 (Red 33), CI 14700 (Red 4), 80% Volumen
Gender: Women

 

Authenticity & Security

100% Authentic & Genuine Fragrances – Guaranteed

At The Perfume Shop USA, we take pride in offering only 100% original brand-name fragrances. Every perfume, cologne, and beauty product featured in our store is authentic and sourced directly from trusted brands and suppliers. We never sell imitations, knock-offs, or counterfeit products—only genuine designer fragrances at unbeatable prices. Shop with confidence, knowing you’re getting the real deal, every time.

Our Security Commitment

At The Perfume Shop USA, we prioritize your safety and privacy to ensure a secure and worry-free shopping experience. Our advanced security measures protect every transaction, giving you complete peace of mind while you shop.

We use Secure Server Software (SSL) encryption to safeguard your personal information, including your name, address, and payment details. This ensures that your data remains private and protected from unauthorized access. Shop with confidence, knowing that your security is our top priority.

Shipping & Returns

1. Shipping & Return Questions

What is your shipping rates & policy?
Standard Ground (USA)
  • Free for orders over $ 59.99, otherwise shipping is $ 5.99.
  • Orders to PO Box, HI, PR, AK, APO, FPO are shipped via USPS.
  • Ships via UPS, FedEx, or Postal Service.
  • Arrives in 2 - 5 business days.
  • Starts at $12.95
  • Arrives in 2 – 3 business days
  • Ships via UPS, FedEx, or Postal Service
  • (not available for P.O. Boxes)
Standard Ground (UK)
  • Complimentary ground shipping within 1 to 8 business days (UK).
  • Free for orders over £ 99.99, otherwise shipping is £ 8.99.
    Ships via Fedex, DHL, UPS, USPS, DPD and other local carriers
Canada
  • Ships via Postal Service for $ 15.99 (CAD).  Arrives in 3 - 10 business days.
  • Canada orders arrive by local post or UPS directly to your door. 
United Arab Emirates 
  • Ships via Postal Service for $ 16.99.
  • Arrives in 3 - 10 business days.
Australia
  • Ships via Postal Service for $ 16.99 (AUD). 
  • Arrives in 3 - 10 business days.

Worldwide Shipping (Shipping costs range depending on your location. Orders typically take 4-15 business days) Ships via Fedex, DHL, UPS, USPS, DPD and other local carriers from $ 4.99 + $ 0.99 per item depending on your country Arrives in 4 - 12 business days with tracking.

2. Returns and Exchanges

Returns Policy

Easy and complimentary, within 14 daysIf you would like to return a product from your order simply send the unopened product back to the address below in its original sealed packaging. You can expect a refund within one billing cycle of our receiving your returned product. If shipping was free for your order it will be deducted from the credit we apply to your credit card. Please note, we do not accept returns for cosmetics and skincare items due to health reasons, please make your selections carefully. Shipping cost is non-refundable for undelivered, unclaimed, returned and refused packages, unless we made an error.Returns Should be sent to :

The Perfume Shop
5065 Main St Suite 189Trumbull CT 06611, USA.

Please contact with our support team for return queries.Email:contact@theperfumeshopusa.com

Reviews

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)