-12%

Shalimar by Guerlain-Body Lotion 6.7 oz

$72.99 USD $63.99 USD SAVE 12%

Size: Body Lotion 6.7 ozSize Guide

Body Lotion 6.7 oz
 More payment options
Buy more and saveDon't miss out on these amazing deals!
Most Popular
Buy 2
Save 3%
$271.98
$263.82
Item 1
Item 2
Best Deal
Buy 3
Save 6%
$407.97
$383.49
Item 1
Item 2
Item 3
4 interest-free payments of $16 with . Check your purchasing power

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Guerlain
SKU: 401499
Availability: In Stock
16 sold in last 23 hours
Order in the next 6 hours 18 minutes to get it between Friday, 4th April and Monday, 7th April
Product Description

Shalimar by Guerlain Body Lotion is a rich, velvety lotion that leaves your skin feeling silky soft, and beautifully scented. This body lotion hydrates and nourishes the skin while enveloping you in a sensuous, oriental aroma. Perfect for daily use, the lotion absorbs quickly, leaving no greasy residue.

Brand Detail:

Guerlain is a prestigious French perfume house known for its pioneering creations in the world of fragrance. It was founded in 1828. Guerlain's craftsmanship and attention to detail have made it a symbol of luxury and refinement. Guerlain continues to enchant the world with scents that evoke emotion and elegance.

Use:

Shalimar by Guerlain Body Lotion is ideal for layering with the Shalimar Eau de Parfum to enhance the fragrance and extend its longevity throughout the day. 

Fragrance Family: Amber, spicy
Top Notes: Bergamot, Citrus, and Lemon
Heart Notes: Jasmine, Rose, and Iris
Base Notes:  Vanilla, Opoponax, and Tonka Bean
Gender: Women
Authenticity & Security

100% Authentic & Genuine Fragrances – Guaranteed

At The Perfume Shop USA, we take pride in offering only 100% original brand-name fragrances. Every perfume, cologne, and beauty product featured in our store is authentic and sourced directly from trusted brands and suppliers. We never sell imitations, knock-offs, or counterfeit products—only genuine designer fragrances at unbeatable prices. Shop with confidence, knowing you’re getting the real deal, every time.

Our Security Commitment

At The Perfume Shop USA, we prioritize your safety and privacy to ensure a secure and worry-free shopping experience. Our advanced security measures protect every transaction, giving you complete peace of mind while you shop.

We use Secure Server Software (SSL) encryption to safeguard your personal information, including your name, address, and payment details. This ensures that your data remains private and protected from unauthorized access. Shop with confidence, knowing that your security is our top priority.

Shipping & Returns

1. Shipping & Return Questions

What is your shipping rates & policy?
Standard Ground (USA)
  • Free for orders over $ 59.99, otherwise shipping is $ 5.99.
  • Orders to PO Box, HI, PR, AK, APO, FPO are shipped via USPS.
  • Ships via UPS, FedEx, or Postal Service.
  • Arrives in 2 - 5 business days.
  • Starts at $12.95
  • Arrives in 2 – 3 business days
  • Ships via UPS, FedEx, or Postal Service
  • (not available for P.O. Boxes)
Standard Ground (UK)
  • Complimentary ground shipping within 1 to 8 business days (UK).
  • Free for orders over £ 99.99, otherwise shipping is £ 8.99.
    Ships via Fedex, DHL, UPS, USPS, DPD and other local carriers
Canada
  • Ships via Postal Service for $ 15.99 (CAD).  Arrives in 3 - 10 business days.
  • Canada orders arrive by local post or UPS directly to your door. 
United Arab Emirates 
  • Ships via Postal Service for $ 16.99.
  • Arrives in 3 - 10 business days.
Australia
  • Ships via Postal Service for $ 16.99 (AUD). 
  • Arrives in 3 - 10 business days.

Worldwide Shipping (Shipping costs range depending on your location. Orders typically take 4-15 business days) Ships via Fedex, DHL, UPS, USPS, DPD and other local carriers from $ 4.99 + $ 0.99 per item depending on your country Arrives in 4 - 12 business days with tracking.

2. Returns and Exchanges

Returns Policy

Easy and complimentary, within 14 daysIf you would like to return a product from your order simply send the unopened product back to the address below in its original sealed packaging. You can expect a refund within one billing cycle of our receiving your returned product. If shipping was free for your order it will be deducted from the credit we apply to your credit card. Please note, we do not accept returns for cosmetics and skincare items due to health reasons, please make your selections carefully. Shipping cost is non-refundable for undelivered, unclaimed, returned and refused packages, unless we made an error.Returns Should be sent to :

The Perfume Shop
5065 Main St Suite 189Trumbull CT 06611, USA.

Please contact with our support team for return queries.Email:contact@theperfumeshopusa.com

Reviews

Customer Reviews

Based on 1 review
100%
(1)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
H
Haven
Effective lotion

I have been wearing Shalimar body lotion for over 50 years.The warm vanilla overotnes suit me expertly.