Shalimar by Guerlain-Body Lotion 6.7 oz

$121.99 USD $78.99 USD SAVE 35%

Size: Body Lotion 6.7 ozSize Guide (Oz to Ml)

Body Lotion 6.7 oz

Guaranteed safe checkout

american expressdiscovervisajcbmasterpaypalklarna-pay-lateraffirmafterpay
Vendor: Guerlain
SKU: 401499
Availability: In Stock Pre order Out of stock
sold in last hours
Order in the next [totalHours] hours %M minutes to get it between and
Add More to Cart, Save Upto 06% β€” Limited Time Offer
Product Description

Shalimar by Guerlain Body Lotion is a rich, velvety lotion that leaves your skin feeling silky soft, and beautifully scented. This body lotion hydrates and nourishes the skin while enveloping you in a sensuous, oriental aroma. Perfect for daily use, the lotion absorbs quickly, leaving no greasy residue.

Brand Detail:

Guerlain is a prestigious French perfume house known for its pioneering creations in the world of fragrance. It was founded in 1828. Guerlain's craftsmanship and attention to detail have made it a symbol of luxury and refinement. Guerlain continues to enchant the world with scents that evoke emotion and elegance.

Use:

Shalimar by Guerlain Body Lotion is ideal for layering with the Shalimar Eau de Parfum to enhance the fragrance and extend its longevity throughout the day.Β 

Fragrance Family: Amber, spicy
Top Notes: Bergamot, Citrus, and Lemon
Heart Notes: Jasmine, Rose, and Iris
Base Notes:Β  Vanilla, Opoponax, and Tonka Bean
Gender: Women
Authenticity & Security

100% Authentic & Genuine Fragrances – Guaranteed

At The Perfume Shop , we take pride in offering only 100% original brand-name fragrances. Every perfume, cologne, and beauty product featured in our store is authentic and sourced directly from trusted brands and suppliers. We never sell imitations, knock-offs, or counterfeit productsβ€”only genuine designer fragrances at unbeatable prices. Shop with confidence, knowing you’re getting the real deal, every time.

Our Security Commitment

At The Perfume Shop USA, we prioritize your safety and privacy to ensure a secure and worry-free shopping experience. Our advanced security measures protect every transaction, giving you complete peace of mind while you shop.

We use Secure Server Software (SSL) encryption to safeguard your personal information, including your name, address, and payment details. This ensures that your data remains private and protected from unauthorized access. Shop with confidence, knowing that your security is our top priority.

Shipping & Returns

1. Shipping & Return Questions

What is your shipping rates & policy?
Standard Ground (USA)
  • Free for orders over $ 59.99, otherwise shipping is $ 5.99.
  • Orders to PO Box, HI, PR, AK, APO, FPO are shipped via USPS.
  • Ships via UPS, FedEx, or Postal Service.
  • Arrives in 2 - 5 business days.
2nd Day Air (USA)
  • Starts at $12.95
  • Arrives in 2 – 3 business days
  • Ships via UPS, FedEx, or Postal Service
  • (not available for P.O. Boxes)
Standard Ground (UK)
  • Complimentary ground shipping within 3 to 7 business days (UK).
  • Free for orders over Β£ 99.99, otherwise shipping is Β£ 5.99.
    Ships via Fedex, DHL, UPS, USPS,Β DPDΒ and other local carriers
  • You will NOT be charged any additional fees when you receive your package.

2. Returns and Exchanges

Returns Policy

Easy and complimentary, within 30 days. If you would like to return a product from your order simply send the unopened product back to the address below in its original sealed packaging. You can expect a refund within one billing cycle of our receiving your returned product. If shipping was free for your order it will be deducted from the credit we apply to your credit card. Please note, we do not accept returns for cosmetics and skincare items due to health reasons, please make your selections carefully. Shipping cost is non-refundable for undelivered, unclaimed, returned and refused packages, unless we made an error.

Please contact with our support team for return queries.Email:contact@theperfumeshopusa.com

Buying Tips

What’s the difference between Perfume, Eau de Parfum, Eau de Toilette and Cologne?

  • Perfume (Parfum/Extrait) highest oil about 15-30% with richest scent and longest wear using few sprays.
  • Eau de Parfum (EDP) mid to high oil about 10-15% offering long-lasting balanced wear for daily use.
  • Eau de Toilette (EDT) medium to light oil about 5-20% lighter projection and easy to reapply.
  • Cologne (EdC) light oil about 2-5% fresh feel and shorter wear for quick refreshes.

What’s the difference between Mini Travel Sprays & Samples (Vials)?

  • Travel Sprays (Mini) portable spray sizes for travel or gym with easy reapplication and try before you buy flexibility.
  • Sample (Vials) small testers to wear on skin over time so you can choose the right scent before a full bottle.

Are Tester bottles authentic?

Yes, testers are 100% authentic and full; they often ship in plain packaging and may arrive without a cap, hence the lower price.

How should I store my fragrance?

Keep bottles sealed, in a cool, dry, dark place, ideally inside their boxes, to help them last up to about three years.

Reviews

Customer Reviews

Based on 1 review
100%
(1)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
H
Haven
Effective lotion

I have been wearing Shalimar body lotion for over 50 years.The warm vanilla overotnes suit me expertly.

Buy More Save More Discount Offer - The Perfume Shop